PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007682-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 648aa    MW: 72219 Da    PI: 8.3554
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007682-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-1760106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +avk + g++Wk+Ia+ ++  R++ qc +rwqk+l
    NNU_007682-RA  60 KGGWTPEEDETLRKAVKAFKGKCWKKIAEFFP-DRSEVQCLHRWQKVL 106
                      688*****************************.************986 PP

2Myb_DNA-binding61.41.8e-19112158148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v ++G+  W+ Ia+ ++ gR +kqc++rw+++l
    NNU_007682-RA 112 KGPWTQEEDDRIIELVSKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 158
                      79******************************.*************97 PP

3Myb_DNA-binding29.71.5e-09164195134
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkg 34 
                      +++WT eE++ l +a++ +G++ W+ Ia+ ++ g
    NNU_007682-RA 164 KDAWTLEEELALMNAHRIHGNK-WAEIAKVLP-G 195
                      679*******************.******999.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.55555106IPR017930Myb domain
SuperFamilySSF466899.33E-1557113IPR009057Homeodomain-like
SMARTSM007171.2E-1559108IPR001005SANT/Myb domain
PfamPF002491.6E-1560106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2262113IPR009057Homeodomain-like
CDDcd001672.03E-1363106No hitNo description
PROSITE profilePS5129431.25107162IPR017930Myb domain
SuperFamilySSF466891.46E-25109195IPR009057Homeodomain-like
SMARTSM007172.6E-18111160IPR001005SANT/Myb domain
PfamPF002491.2E-18112158IPR001005SANT/Myb domain
CDDcd001672.39E-15114158No hitNo description
Gene3DG3DSA:1.10.10.608.8E-27114161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-21162236IPR009057Homeodomain-like
PROSITE profilePS5129415.042163236IPR017930Myb domain
SMARTSM007175.5E-12163234IPR001005SANT/Myb domain
PfamPF002495.7E-11164230IPR001005SANT/Myb domain
CDDcd001679.47E-8166232No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MMAEVKHEQC CLENKQSAAA SSSSVSEGSC SIALKSPVIC SPASTSPYHR RTTGPIRRAK  60
GGWTPEEDET LRKAVKAFKG KCWKKIAEFF PDRSEVQCLH RWQKVLNPEL IKGPWTQEED  120
DRIIELVSKY GPTKWSVIAK SLPGRIGKQC RERWHNHLNP MIKKDAWTLE EELALMNAHR  180
IHGNKWAEIA KVLPGSKEER FQIQISEGFC ILTLEISSRT DNSIKNHWNS SLKKKLDFYL  240
ATGKLPPTPK ASTQNGVKDA SKPADTGKPA IFSNKGLDST AQASPGIERV CNLENCKDLV  300
ESSNQGFLDI DGSMDVPVSR FVDSVDAESK TMASKLDTFC GITDLTPKFE KHGSTAKIDN  360
DNKVADTVQF EVPTFGSLYY EPPKLENCGI TSDSVLLNTY CSMQQGYDSS ALMPLVSLFT  420
PPCVKGTDLD GKSPESILKN AAKSFPNTPS ILRKRKREVN AVSSHDRIVQ RDMVRANNGS  480
SASEDKEKSG KSAEQSGSLN ESLCEVPACH GNDKTEMYNG KAFNASPPYR LRSSKRTAVF  540
KSVEKQLDFT LDEEKVEGFT KSMILGNHCV TEDCSHATKM AVTYDDSWEY SSTWRLKMFT  600
SPKAIKCLYF YNNEKEITMN NLPSSYKACI VISINLLPGR FISFIRQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-65592365159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-65592365159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256935.10.0PREDICTED: myb-related protein B
RefseqXP_010256936.10.0PREDICTED: myb-related protein B
TrEMBLF6HLC50.0F6HLC5_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-145myb domain protein 3r-5